DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2c38

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_034132.2 Gene:Cyp2c38 / 13097 MGIID:1306819 Length:490 Species:Mus musculus


Alignment Length:520 Identity:140/520 - (26%)
Similarity:229/520 - (44%) Gaps:103/520 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLD--RYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNG 118
            |||.|:|||||...:|  .:..|    .|..::.||.:::|..|....:|::..|.::|.|..:|
Mouse    31 PGPTPFPIIGNFLQIDVKNFNQS----LTNFSKTYGPVFTLYLGSRPIVVLHGYEAVKEALIDHG 91

  Fly   119 KVMSGRPDFIRYHKLFGG-----ERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIG 178
            :..|||.:.....|:..|     ...||     |.:              .|.|:...::...:|
Mouse    92 EEFSGRENIPMSEKINNGLGITFSNGNS-----WKE--------------TRRFTLMTLRNLGMG 137

  Fly   179 CEEMEHWNRELGNQLV------PGEPINIKPLILKACANMFSQYMCSL----RFDYDDVDFQQIV 233
            ...:|...||....||      .|.|.:  |..:.:||.  ...:||:    ||||.|.||..::
Mouse   138 KRNIEDRVREEAQCLVEELRKTKGSPCD--PTFILSCAP--CNVICSIIFQDRFDYKDKDFLMLM 198

  Fly   234 QYFDEIFWEINQGHPLDFLPWL-----YPFYQRHL----NKIINWSSTIRGFIMERIIRHRELSV 289
            :       ::|:...:...|||     :|....:.    :|::.....||.:::|::..|:| |:
Mouse   199 K-------KLNENVKILSSPWLQVCNNFPLLIDYCPGSHHKVLKNFKYIRSYLLEKVKEHQE-SL 255

  Fly   290 DLDEPDRDFTDALL-----KSLLEDKDVSRNTIIFMLED-FIGGHSAVGNLVMLVLAYIAKNVDI 348
            |:..| |||.|..|     .:.:|..:.|...::..:.: |..|.......:...|..:.|..|:
Mouse   256 DVTNP-RDFIDYFLIKQKQANHIEQAEYSLENLVCTINNLFAAGTETTSTTLRYALLLLMKYPDV 319

  Fly   349 GRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSS--SPIVPHVATEDTVISGYGVTK 411
            ..::|||||.:: ..:||..:.|.:.||||.|.|.||.|:.:  ...:||..|.|.....|.:.|
Mouse   320 TAKVQEEIDHVV-GRHRSPCMQDRSRMPYTDAMIHEVQRFINLVPNNLPHAVTCDIKFRNYIIPK 383

  Fly   412 GTIVFIN-NYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHF 475
            ||.|..: ..||:.|::| .||:.|:|..||:.:     .|.|.||                 :|
Mouse   384 GTTVVTSLTSVLHDSKEF-PNPEMFDPGHFLDAN-----GNFKKSD-----------------YF 425

  Fly   476 LPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISS-HNPSTIKISP---ESLALPAD---CF-PL 532
            :.||.|||.|.|:.|.|...||::..::|.:.:.| .:|..|.:.|   ..:.||..   || ||
Mouse   426 MTFSAGKRVCAGEGLARMELFLILTTILQNFKLKSLVHPKDIDMIPFVNGLITLPPHYQLCFIPL 490

  Fly   533  532
            Mouse   491  490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 140/520 (27%)
Cyp2c38NP_034132.2 p450 30..487 CDD:278495 136/515 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.