DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and cyp1c1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001191176.1 Gene:cyp1c1 / 100496802 -ID:- Length:524 Species:Xenopus tropicalis


Alignment Length:521 Identity:143/521 - (27%)
Similarity:238/521 - (45%) Gaps:86/521 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||.|||::||...|.:.   |...|..::|:||:::.:..|....:|:|....|||.|.::.|.
 Frog    47 PGPFPWPVVGNAMQLGQL---PHLTFCKMSQKYGNVFQIRLGTQDIVVLNGDSTIREALVKHSKE 108

  Fly   121 MSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHW 185
            .:|||:|..:..:.||:   |:|...:|.|.:.::.:|  |.:.|.||....|            
 Frog   109 FAGRPNFSSFQLISGGK---SIAFGGYSTLWKAQKKIA--HSTLRAFSTVNSK------------ 156

  Fly   186 NRELGNQLVPGEPINIKPLIL------------KACANMFSQYMCSL----RFDYDDVDFQQIVQ 234
            .::|..:.|..|..::..:.|            :.|....:..:|:|    |:.:||.:|:.::.
 Frog   157 TQKLFEKHVVAEAQDLIDVFLRLTSEEEYFDPTRECTVAAANVICALCFGKRYSHDDEEFKALIG 221

  Fly   235 YFDEIFWEINQGHPLDFLPWLYPF-------YQRHLNKIINWSSTIRGFIMERIIRHRELSVDLD 292
            ..|:....:..|..:|.:|||..|       ||..  |.:||.  ..||:.|::..||:..    
 Frog   222 RNDKFGQTVGAGSLVDIMPWLLTFPNPVRSLYQSF--KDLNWE--FYGFVKEKVSHHRQTY---- 278

  Fly   293 EPD--RDFTDALLKSL-----LEDKD-VSRNTIIFMLEDFIG-GHSAVGNLVMLVLAYIAKNVDI 348
            .|:  ||.:||.:..:     :|..| :|::.:..::.|.:| |.......:..:|..:.|..||
 Frog   279 NPEIARDMSDAFISHIDNAEGIEAGDGLSKDYVESIVNDILGAGQDTTATALTWILLLLIKYPDI 343

  Fly   349 GRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTK 411
            .:::|||||.:: ..||.....|...:||..|.|:|.||:|| .|: :||..|.|.||.|:.:.|
 Frog   344 QQKLQEEIDLVV-GPNRLPTADDKVQLPYVQAFIYEALRFSSFVPVTIPHSTTSDVVIDGFYIPK 407

  Fly   412 GTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPH-F 475
            .|:||:|.:.:|..|..|.||..|:|.|||:                     |:.||.|:... .
 Frog   408 DTVVFVNQWSVNHDESKWKNPDVFDPSRFLD---------------------EEGQLDRDAAFGV 451

  Fly   476 LPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTPREKI 540
            :.||:|||.|||..|.....||.....:.:..:.. ||..|........|.....|..::.|.::
 Frog   452 MIFSVGKRRCIGDQLSMLQIFLCTAIFLHQCTLHG-NPKEIPTMDCISGLSLKPLPYGMSVRARV 515

  Fly   541 G 541
            |
 Frog   516 G 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 142/518 (27%)
cyp1c1NP_001191176.1 p450 46..507 CDD:278495 140/510 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 1 1.010 - - D278622at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.