DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)psg2 and Toporsl

DIOPT Version :9

Sequence 1:NP_647974.1 Gene:l(3)psg2 / 38630 FlyBaseID:FBgn0035617 Length:1929 Species:Drosophila melanogaster
Sequence 2:NP_001343222.1 Gene:Toporsl / 68274 MGIID:1915524 Length:683 Species:Mus musculus


Alignment Length:313 Identity:68/313 - (21%)
Similarity:112/313 - (35%) Gaps:107/313 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 SKEKDEVGGE----PRNTASGKSQERDQSRGKTKDRSRERDRTRNKTREKSQARDQTRSKANDAE 432
            ||:|..|...    |:..:..|||     ||     .::..:|.|||.:.|.:..:...|     
Mouse   259 SKKKSTVSAPAFSFPQELSFMKSQ-----RG-----IKQSKKTWNKTGQSSDSGLKQFPK----- 308

  Fly   433 HTRAKSRKRSSSRDKRREKSKEKLGDKEKNEDLSKEKLEGKSTEHSEKRNESKVKNKD------- 490
                                    |...||..:        ||.|.:..|:..|..||       
Mouse   309 ------------------------GHSSKNPQI--------STTHQKPANKRHVWTKDEWGSDDF 341

  Fly   491 ------TNEEN-ANKKLRERSKD--RNHSKERLHERTQ--------NKSEERKPEAKKVRNAIEN 538
                  ||..| |..:.|...|:  ||.::|:..|.|:        .||.|..|   .:..|:.:
Mouse   342 RGVVCTTNSLNWAYLRARRLDKEYYRNDNREKKSESTKLPPGHVQDLKSHETSP---NIFRALVD 403

  Fly   539 SKEAPTDR---KKDKLLGPLGEKTDERSKDKQIKRSREQS---VTKCPKESGKDTLMEHPPQENG 597
            |.:||..:   ::..:|.| |::...:.|:.:.|:..|.|   :.:.|||.   .|::...:|:.
Mouse   404 SNQAPPKKYNIRETNVLDP-GQQVHYQKKETERKKLEESSLKALQRLPKER---ILIKSKSRESN 464

  Fly   598 ---LDGSKRSSMPHES----------------FSESAKTREHASRRKNQTLSP 631
               |..|:.|:.|..:                .|:..:...|.|||..:..||
Mouse   465 HSCLCVSENSTSPTRNDKMLTSISKKMVRCSQSSQCVEVGSHHSRRTQRQYSP 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)psg2NP_647974.1 PRP38_assoc 374..450 CDD:289628 14/79 (18%)
ToporslNP_001343222.1 DUF4553 <357..514 CDD:373549 36/163 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.