DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)psg2 and CG18605

DIOPT Version :9

Sequence 1:NP_647974.1 Gene:l(3)psg2 / 38630 FlyBaseID:FBgn0035617 Length:1929 Species:Drosophila melanogaster
Sequence 2:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster


Alignment Length:245 Identity:50/245 - (20%)
Similarity:88/245 - (35%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQAAGGSAVGMEQPATGKQLKPPEDLQDNDTNSLEPGEV--VTPPHYHPSSPAVKKHLSKELMI 63
            |.:..||:...|:...   ||.....:..:..|:...|:|  .|.......:.|..:..::....
  Fly   188 MMERYGGAPFLMKMDG---QLVTARIIPSSQANAPNQGQVNQQTQSQAQAQAQAQAQVQAQAQAQ 249

  Fly    64 SKTLRKLPVSVVEQARKENGSGGTPNAQAED--ADDSEGLYSESDSS--GEDLKNVEDVQKARKE 124
            ::|..:.....:.||:.:......|.||.:.  |..::.|..:...:  ....:.|...|::.::
  Fly   250 AQTQAQTQAQALAQAQAQAQVQAQPQAQVQQAAAQPAQLLLPQLTQAVIQTQQRAVHQPQQSGQQ 314

  Fly   125 KQEEAAAATLPQAPPTPFLGINPLRFHMRAPCFEFPRMGFMPRMN--RGG----PRGMRPTFFGR 183
            ...:.|::|...|.|...|.:.          |...|..|:...|  :||    |.|....|.. 
  Fly   315 SGPQHASSTAALATPLEDLELG----------FAIERSMFVGASNADQGGDFILPYGQVFRFAN- 368

  Fly   184 PPAANRMGAPMMG---GLPTQGPPPGAYAPQNPPPTGINSNSGRCKRLQS 230
               .||...|..|   |.....|||....|.|  |...:::.||.:|.|:
  Fly   369 ---TNRAARPSNGNGSGSGVMNPPPAPPVPNN--PRNASAHQGRRRRTQN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)psg2NP_647974.1 PRP38_assoc 374..450 CDD:289628
CG18605NP_001188974.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447074
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.