DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)psg2 and SPCC825.05c

DIOPT Version :9

Sequence 1:NP_647974.1 Gene:l(3)psg2 / 38630 FlyBaseID:FBgn0035617 Length:1929 Species:Drosophila melanogaster
Sequence 2:NP_588055.1 Gene:SPCC825.05c / 2539459 PomBaseID:SPCC825.05c Length:301 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:59/272 - (21%)
Similarity:106/272 - (38%) Gaps:67/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 VSFVFNLVSECSNTKHENCRTKAETTDHNSKESKL--------------PSETKSTEPL----IE 287
            ::||:.::.|.         .:|..|..:..||.|              .:.|..||.|    |.
pombe    67 INFVYGMLEEA---------VEASKTSDSQNESTLDPRKVQLNLTGFLESNATAFTEELWSLIIS 122

  Fly   288 NNRSR-ELPQHKNYVRGKTSNRSHDRTQNRGRTRERSKESHGKSTENSKNKDEGRGKGRERDLF- 350
            .:::: .:|:.....:.:..::..|||       |.|||.....|::| |:.|.|   ||...: 
pombe   123 ASQNQYGIPEKFILEKKEEISKLKDRT-------EASKEESKTVTDHS-NRRESR---RESTYYD 176

  Fly   351 -RRKSRERSQDKNLNRAKSMNLS-KEKDEVGGEPRNTASGKSQERDQSRGKTKD--------RSR 405
             |.::.:|:....|:|.:..:.| .|::..|..|    |..|:..::.||:..|        :.|
pombe   177 SRERNGKRTSRSTLDRKRFHDASDTERNRYGRSP----SPHSRFSEKPRGERYDIRSYSRSHKER 237

  Fly   406 ERDRTRNKTREKSQARDQTRSKANDAEHTRAKSRKRSSSRDKRREKSKEKLGDKEKNEDLSKEKL 470
            ..||.|...|.:...|  ||......|..|::..:...||...|||.:           ..::.|
pombe   238 YEDRYRPTRRRERHYR--TRDDEGFDEFGRSRDGRWRESRTSYREKHR-----------YDRDAL 289

  Fly   471 EGKSTEHSEKRN 482
            ..:|...::|.:
pombe   290 SSESDSGTQKHD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)psg2NP_647974.1 PRP38_assoc 374..450 CDD:289628 20/83 (24%)
SPCC825.05cNP_588055.1 PWI 45..126 CDD:279781 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.