DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bc10 and blcap

DIOPT Version :10

Sequence 1:NP_647972.1 Gene:bc10 / 38628 FlyBaseID:FBgn0040239 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_571568.1 Gene:blcap / 57918 ZFINID:ZDB-GENE-000330-7 Length:87 Species:Danio rerio


Alignment Length:78 Identity:50/78 - (64%)
Similarity:56/78 - (71%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCLQCLLPVLLIPKPSNPALMETHVMFIVLYLVGFFLERKPCTICSLVFLTAVSLICYSGVGNC 65
            |||||.||||||||||.||||...|.||:..||:.|.|||||||||:||||.|:.|||||    |
Zfish     1 MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS----C 61

  Fly    66 IFWGNCEGHQCEN 78
              ||||..:.|.:
Zfish    62 --WGNCFLYHCHD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bc10NP_647972.1 BC10 1..65 CDD:369052 44/63 (70%)
blcapNP_571568.1 BC10 1..65 CDD:369052 47/69 (68%)

Return to query results.
Submit another query.