DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bc10 and blcap

DIOPT Version :9

Sequence 1:NP_647972.1 Gene:bc10 / 38628 FlyBaseID:FBgn0040239 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_571568.1 Gene:blcap / 57918 ZFINID:ZDB-GENE-000330-7 Length:87 Species:Danio rerio


Alignment Length:78 Identity:50/78 - (64%)
Similarity:56/78 - (71%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCLQCLLPVLLIPKPSNPALMETHVMFIVLYLVGFFLERKPCTICSLVFLTAVSLICYSGVGNC 65
            |||||.||||||||||.||||...|.||:..||:.|.|||||||||:||||.|:.|||||    |
Zfish     1 MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS----C 61

  Fly    66 IFWGNCEGHQCEN 78
              ||||..:.|.:
Zfish    62 --WGNCFLYHCHD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bc10NP_647972.1 BC10 1..65 CDD:284203 44/63 (70%)
blcapNP_571568.1 BC10 1..65 CDD:369052 47/69 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589161
Domainoid 1 1.000 99 1.000 Domainoid score I7074
eggNOG 1 0.900 - - E1_KOG4489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4996
OMA 1 1.010 - - QHG48830
OrthoDB 1 1.010 - - D1521316at2759
OrthoFinder 1 1.000 - - FOG0007206
OrthoInspector 1 1.000 - - oto39162
orthoMCL 1 0.900 - - OOG6_109697
Panther 1 1.100 - - LDO PTHR13259
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3213
SonicParanoid 1 1.000 - - X5315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.