DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bc10 and Blcap

DIOPT Version :10

Sequence 1:NP_647972.1 Gene:bc10 / 38628 FlyBaseID:FBgn0040239 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_058612.3 Gene:Blcap / 53619 MGIID:1858907 Length:87 Species:Mus musculus


Alignment Length:78 Identity:50/78 - (64%)
Similarity:57/78 - (73%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCLQCLLPVLLIPKPSNPALMETHVMFIVLYLVGFFLERKPCTICSLVFLTAVSLICYSGVGNC 65
            |||||.||||||||||.||||..:|.||:..||:.|.|||||||||:||||.|:.|||||    |
Mouse     1 MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS----C 61

  Fly    66 IFWGNCEGHQCEN 78
              ||||..:.|.:
Mouse    62 --WGNCFLYHCSD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bc10NP_647972.1 BC10 1..65 CDD:369052 44/63 (70%)
BlcapNP_058612.3 BC10 1..65 CDD:369052 47/69 (68%)

Return to query results.
Submit another query.