DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bc10 and Blcap

DIOPT Version :9

Sequence 1:	NP_647972.1	Gene:	bc10 / 38628	FlyBaseID:	FBgn0040239	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_598266.1	Gene:	Blcap / 171113	RGDID:	621666	Length:	87	Species:	Rattus norvegicus

Alignment Length:	78	Identity:	50/78 - (64%)
Similarity:	57/78 - (73%)	Gaps:	6/78 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MYCLQCLLPVLLIPKPSNPALMETHVMFIVLYLVGFFLERKPCTICSLVFLTAVSLICYSGVGNC 65
            |||||.||||||||||.||||..:|.||:..||:.|.|||||||||:||||.|:.|||||    |
  Rat     1 MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS----C 61

  Fly    66 IFWGNCEGHQCEN 78
              ||||..:.|.:
  Rat    62 --WGNCFLYHCSD 72

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bc10	NP_647972.1	BC10	1..65	CDD:284203	44/63 (70%)
Blcap	NP_598266.1	BC10	1..65	CDD:369052	47/69 (68%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166347632
Domainoid	1	1.000	99	1.000	Domainoid score	I6981
eggNOG	1	0.900	-	-		E1_KOG4489
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	99	1.000	Inparanoid score	I4909
OMA	1	1.010	-	-		QHG48830
OrthoDB	1	1.010	-	-		D1521316at2759
OrthoFinder	1	1.000	-	-		FOG0007206
OrthoInspector	1	1.000	-	-		oto96103
orthoMCL	1	0.900	-	-		OOG6_109697
Panther	1	1.100	-	-	LDO	PTHR13259
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X5315
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
	15	14.770