DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkr and TACR2

DIOPT Version :9

Sequence 1:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001048.2 Gene:TACR2 / 6865 HGNCID:11527 Length:398 Species:Homo sapiens


Alignment Length:423 Identity:119/423 - (28%)
Similarity:187/423 - (44%) Gaps:78/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAEEEAEFERLYAAPAEIVALLSIFYGGISIVAVIGNTLVIWVVATTRQMRTVTNMYIANLAFAD 81
            |.|........::.|:..:||.:..|..:.:|||.||.:|||::...|:||||||.:|.|||.||
Human    15 GPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALAD 79

  Fly    82 VIIGLFCIPFQFQAALLQSWNLPWFMCSFCPFVQALSVN---VSVFTLTAIAIDRHRAIINPLRA 143
            :.:..|...|.|..|   |.|:.:|..:||.|.....:.   ||::::||||.||:.||::|.:.
Human    80 LCMAAFNAAFNFVYA---SHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQP 141

  Fly   144 RPTKFVSKFIIGGIWMLALLFAVPFAIAFRVEELTERFRENNETYNVTRPFCMNKNLSDDQ---- 204
            |.:...:|.:|.|||::||..|                          .|.|....::.||    
Human   142 RLSAPSTKAVIAGIWLVALALA--------------------------SPQCFYSTVTMDQGATK 180

  Fly   205 -------------LQSFRYTLVFVQYLVPFCVISFVYIQMAVRLWGTRAPGNAQDSRDITLLKNK 256
                         |..:...::.:.|.:|..|:...|..:.:.||....||:.....::..|:..
Human   181 CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAM 245

  Fly   257 KKVIKMLIIVVIIFGLCWLPLQLYNILYVTIPEINDYHFISIVWFCCDWLAMSNSCYNPFIYGIY 321
            ||.:|.:::||:.|.:||||..||.||.....:|..:.||..|:....|||||::.|||.||...
Human   246 KKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCL 310

  Fly   322 NEKFKREFNKRFAACFCKFKTSMDAHE--RTFSMHTRASSIRSTYANSSMRIRSNLFGPARGGVN 384
            |.:|:..|...|..|.....|..|..|  .|.|:.||.:...:         :..||        
Human   311 NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHT---------KETLF-------- 358

  Fly   385 NGKPGLHMPRVHGSGANSGIYNGSSGQNNNVNG 417
                      :.|..|.|...:|.:|:..:.:|
Human   359 ----------MAGDTAPSEATSGEAGRPQDGSG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LkrNP_647968.3 7tm_4 46..329 CDD:304433 95/302 (31%)
7tm_1 52..318 CDD:278431 88/285 (31%)
PHA03216 467..>519 CDD:177558
TACR2NP_001048.2 7tm_4 42..>168 CDD:304433 52/154 (34%)
7tm_1 50..307 CDD:278431 88/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.