DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkr and CG13575

DIOPT Version :9

Sequence 1:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster


Alignment Length:358 Identity:79/358 - (22%)
Similarity:142/358 - (39%) Gaps:84/358 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SIFYGGISIVAVIGNTLVIWVVATTRQMRTVTNMYIANLAFADVIIGLFC-IPF--QFQAALLQS 100
            |...|.:.::|..||...:: |.:.|::|......:.:||.:|::..:|| :.:  ||||..||.
  Fly    54 SAVVGTLFVLAFCGNLSTLY-VNSRRKLRPFFRACLISLACSDLVSSIFCTVSYMAQFQAQYLQL 117

  Fly   101 WNLPWFMCSFCPFVQALSVNVSVFTLTAIAIDRHRAIINPLRA--RPTKFVSKFIIGGIWMLALL 163
            |.:..|||.|.||:...||.....||.|||:||:.|::.|:..  .|.|..|...:..||..::.
  Fly   118 WTIGGFMCKFVPFITTTSVLSGSLTLVAIALDRYLAVMRPVLGFWSPDKRFSTLSMLLIWACSIG 182

  Fly   164 FAVPF--------AIAFRVEELTERFRE----NNETYNVTRPFCMNKNLSDDQLQSFRYTLVFVQ 216
            .:.|.        .....||:.:|...|    ..|...||....::..|:.|......|.::|..
  Fly   183 SSGPLLGIYDYRKIYLLDVEDSSEESEEVVTAVPEELVVTELEMVHMCLAGDHDVGLYYVILFTL 247

  Fly   217 YLVPFCVISFVYIQ--MAVRLWGTR---------------------------------------- 239
            ..:| |::||:::.  :|.:||..|                                        
  Fly   248 IFLP-CIVSFLWLNAVIARQLWLRRHYHQEQQEQHQEPKEGQFKTMANGGDLLMPSTLVSAMGVA 311

  Fly   240 -----------------APGNAQDSRDITLLKNKKKVIKMLIIVVIIFGLCWLPLQLYNI--LYV 285
                             |||....:..:......:|::.::::::.:|....||..::.|  ||.
  Fly   312 VPFALDNTPLPPKSTVNAPGKKTTAAALAREARHRKMVVVVLLMMAVFICLRLPAWVFLIMRLYG 376

  Fly   286 TIPEINDYHFISIVWFCCDWLAMSNSCYNPFIY 318
            :..|..|:    :::|....|.:.:...||..|
  Fly   377 SYSEPIDW----LLYFSFGILNLFSCALNPIFY 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LkrNP_647968.3 7tm_4 46..329 CDD:304433 77/351 (22%)
7tm_1 52..318 CDD:278431 75/343 (22%)
PHA03216 467..>519 CDD:177558
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 40/121 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.