DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkr and CCHa1-R

DIOPT Version :9

Sequence 1:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:446 Identity:117/446 - (26%)
Similarity:206/446 - (46%) Gaps:65/446 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAMDLIEQESRLEFLPGAEEEAEFERLYAAPAEIVA--------LLSIFYGGISIVAVIGNTLVI 57
            :|| ::.|.::...|.....| .|..|.......|.        ::.|.:..|.:|.|:||..:|
  Fly    41 LAM-VVSQSTQWPLLDTGSSE-NFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLI 103

  Fly    58 WVVATTRQMRTVTNMYIANLAFADVIIGLFCIPFQFQAALLQSWNLPWFMCSFCPFVQALSVNVS 122
            .|..:.||||.|.|.||.:||.||:::.:..:|.......::.|....|:||...|::.:|:.||
  Fly   104 VVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVS 168

  Fly   123 VFTLTAIAIDRHRAIINPLR--------ARPTKFVSKFIIGGIWMLALLFAVPFAIAFRVEELTE 179
            ||||||::.||:.||::|||        .|.|:......: .||:||:|..:|..|...::.|  
  Fly   169 VFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAV-SIWLLAILCGLPALIGSNLKHL-- 230

  Fly   180 RFRENNETYNVTRPFCMNKNLSDDQLQSFRYTLVFVQYLVPFCVISFVYIQMAVRL-WGTRAPGN 243
              ..|.::..:..|:.....::..:.....:.||:  |.:|..||:..|:.:|:.| :....||.
  Fly   231 --GINEKSIVICYPYPEEWGINYAKSMVLLHFLVY--YAIPLVVIAVFYVLIALHLMYSASVPGE 291

  Fly   244 AQDSRDITLLKNKKKVIKMLIIVVIIFGLCWLPLQLYNILYVTIPEIND-----YHFISIVWFCC 303
            .|.:  :..::.::||...::..|:|||:|:||..::.:.:...|...|     :|.:.||.:| 
  Fly   292 IQGA--VRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYC- 353

  Fly   304 DWLAMSNSCYNPFIYGIYNEKFKREFNKRFAACFCK----FKTSMDAHERTFSMHTRASSIRSTY 364
              ::.:|||.||......:..|::.||:..   ||:    .:.....|: ||.|| |.:|:.|| 
  Fly   354 --MSFANSCANPVALYFVSGAFRKHFNRYL---FCRGASGRRKKRGQHD-TFCMH-RDTSLTST- 410

  Fly   365 ANSSMRIRSNLF-------------------GPARGGVNNGKPGLHMPRVHGSGAN 401
            |:...:.|.:.:                   |..:.|.|.....|.:|.:...|.|
  Fly   411 ASKRFQSRHSCYQSTIRSCRLQETTITTLPNGGNQNGANISAVELALPVLQAPGHN 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LkrNP_647968.3 7tm_4 46..329 CDD:304433 85/296 (29%)
7tm_1 52..318 CDD:278431 82/279 (29%)
PHA03216 467..>519 CDD:177558
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 39/99 (39%)
7tm_1 98..364 CDD:278431 81/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.