DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkr and Gpr165

DIOPT Version :9

Sequence 1:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001100052.1 Gene:Gpr165 / 296866 RGDID:1564566 Length:462 Species:Rattus norvegicus


Alignment Length:380 Identity:96/380 - (25%)
Similarity:172/380 - (45%) Gaps:60/380 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MDLIEQESRLEFLPGAEEEAEFERLYAAPAEIVALLSIFYGGISIVAVIGNTLVIWVVATTRQMR 67
            ::::.|:.:::|                      .|.:.|..:...|:|||.::..::...:::.
  Rat    92 LEIVSQDEQVQF----------------------WLVVGYTIVVFAAIIGNWVLNHIIMKYKRVH 134

  Fly    68 TVTNMYIANLAFADVIIGLFCIPFQFQAALLQSWNLPWFMCSFCPFVQALSVNVSVFTLTAIAID 132
            |.|.:::.|::..::::.|...||.....|..|.......|....|.|.....|:|.::.||::|
  Rat   135 TATGLFVVNISVTNMMLALLSSPFTMVRYLCNSLVFGKMTCHLSRFAQYSCAYVTVMSMAAISLD 199

  Fly   133 RHRAIINPLRARPTKFVSKFIIGGIWMLALLFAVPFAIAFRVEELTERFRENNETYNVTRPFCMN 197
            |||.::.||:||.|.......|..||:::...|:|.|:..::.::        |..|.|..... 
  Rat   200 RHRVMLYPLKARITPMQGNVCIIIIWIVSTCAALPHAVYQKLYQV--------EFGNTTEESAC- 255

  Fly   198 KNLSDDQLQSFRYT-------------LVFVQYLVPFCVISFVYIQMAVRLWGTRAPGNAQDSRD 249
                   |.||.||             |:|  :::|..|:..||..:|.:||...|..:......
  Rat   256 -------LPSFPYTSKSTWKYLDLGTFLLF--FILPLLVLVAVYGHVAKKLWIHDAVDDINIHTY 311

  Fly   250 ITLLKNKKKVIKMLIIVVIIFGLCWLPLQLYNILYVTIPEINDYHFISIVWFCCDWLAMSNSCYN 314
            |.....||:.:|||:.||:::.:.||||.||.:| ::...|:.::.:   :|...|||:|:||||
  Rat   312 ICQRGKKKQTLKMLMTVVLLYTISWLPLNLYLVL-LSSESISSHNGL---YFFLHWLAISSSCYN 372

  Fly   315 PFIYGIYNEKFKREFNKRFAACFCKFKTSMDAHERTFSMHTRASSIRSTYANSSM 369
            |:||...::.|:.|..|.....   .|..:|...|....|.|.||:..|....|:
  Rat   373 PYIYCWLSDSFRIEVQKVIMEI---QKMLLDKISRLRGEHRRLSSVSHTQTPGSV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LkrNP_647968.3 7tm_4 46..329 CDD:304433 81/295 (27%)
7tm_1 52..318 CDD:278431 76/278 (27%)
PHA03216 467..>519 CDD:177558
Gpr165NP_001100052.1 7tmA_GPR83 103..387 CDD:320511 84/327 (26%)
TM helix 1 105..129 CDD:320511 6/23 (26%)
TM helix 2 138..160 CDD:320511 4/21 (19%)
TM helix 3 176..198 CDD:320511 6/21 (29%)
TM helix 4 219..235 CDD:320511 4/15 (27%)
TM helix 5 268..291 CDD:320511 5/24 (21%)
TM helix 6 322..344 CDD:320511 11/21 (52%)
TM helix 7 355..380 CDD:320511 12/27 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1254727at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X257
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.