DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkr and Gpr83

DIOPT Version :9

Sequence 1:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_536336.1 Gene:Gpr83 / 140595 RGDID:619891 Length:422 Species:Rattus norvegicus


Alignment Length:320 Identity:107/320 - (33%)
Similarity:169/320 - (52%) Gaps:24/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLYAAPAE---IVALLSIFYGGISIVAVIGNTLVIWVVATTRQMRTVTNMYIANLAFADVIIGLF 87
            |.|.|.::   :.|||.:.|..|.:.::.||.||..|:...::|.:.|:::|.|||.||::|.|.
  Rat    58 RRYGAESQNPTVKALLIVAYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLL 122

  Fly    88 CIPFQFQAALLQSWNLPWFMCSFCPFVQALSVNVSVFTLTAIAIDRHRAIINPLRARPTKFVSKF 152
            ..||.....:..:|.....||....|.|..|::||..||||||:|||:.|::||:.|.:......
  Rat   123 NTPFTLVRFVNSTWVFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVI 187

  Fly   153 IIGGIWMLALLFAVPFAIAFRVEELTERFRENNETYNVTRPFCMNKNLSD-----DQLQSFRYTL 212
            .|..||::|..|::|.||..::  .|.::.|     ::.|..|    |.|     |....:....
  Rat   188 YIAVIWVMATFFSLPHAICQKL--FTFKYSE-----DIVRSLC----LPDFPEPADLFWKYLDLA 241

  Fly   213 VFV-QYLVPFCVISFVYIQMAVRLWGTRAPGNAQDSRDITLLKNKKKVIKMLIIVVIIFGLCWLP 276
            .|: .||:|..:||..|.::|.:||.....|:....:.:.|.:.||..:|||::||::|.|||.|
  Rat   242 TFILLYLLPLFIISVAYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVLFALCWFP 306

  Fly   277 LQLYNILYVTIPEINDYHFISIVWFCCDWLAMSNSCYNPFIYGIYNEKFKREFNKRFAAC 336
            |..| :|.::...|   |..:.::|...|.|||::|||||||...||.|:.|.....:.|
  Rat   307 LNCY-VLLLSSKAI---HTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALLSMC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LkrNP_647968.3 7tm_4 46..329 CDD:304433 97/288 (34%)
7tm_1 52..318 CDD:278431 92/271 (34%)
PHA03216 467..>519 CDD:177558
Gpr83NP_536336.1 7tm_4 77..>224 CDD:304433 52/157 (33%)
7tm_1 87..344 CDD:278431 92/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1254727at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.