DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkr and Tre1

DIOPT Version :9

Sequence 1:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster


Alignment Length:390 Identity:82/390 - (21%)
Similarity:161/390 - (41%) Gaps:76/390 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EEEAEFERLYAAPAEIVALLS--IFYGGISIVAVIGNTLVIWVVATTRQMRT-VTNMYIANLAFA 80
            |..|..:.:|...|.:.|.:|  :|.    .:.|:||.:.:..:..:..:|. .|..::.:|:.:
  Fly    21 EPAAATQSIYPHSATLFAAISACVFV----TIGVLGNLITLLALLKSPTIREHATTAFVISLSIS 81

  Fly    81 DVIIGLFCIPFQFQAALLQSWNLPWFMCSFCPFVQALSVNVSVFTLTAIAIDRHRAIINPLRARP 145
            |::...|.:|........:||.....:|...|.:...:|.||:.::..|.::|:  |:....:|.
  Fly    82 DLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRY--ILIACHSRY 144

  Fly   146 TK-FVSKFI---IGGIWMLALLFAVPFAIAFRVEELTERFRENNETYNVTRPFCMNKNLSDDQLQ 206
            :: :..|||   :..:|.::.|..:|..:....|     ...:..|::.|        :...:.:
  Fly   145 SQIYKPKFITLQLLFVWAVSFLLLLPPILGIWGE-----MGLDEATFSCT--------ILKKEGR 196

  Fly   207 SFRYTLVFVQYLVPFCVI----SFVYI---------------QMAVRLWGTRAPGNAQDSRDIT- 251
            |.:.||..:.:|:|..||    |.:||               |:|.....:.:.|.:..:...| 
  Fly   197 SIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTR 261

  Fly   252 LLKNKKKVIKMLIIVVIIFGLCWLPLQLYNILYVTIPEINDYHFISIVW--FCCDWLAMSNSCYN 314
            ..:...::..|::.:.:.|.:|:|||.|.|:       ::|....|..|  .....:|.::|..|
  Fly   262 KAREDNRLTVMMVTIFLCFLVCFLPLMLANV-------VDDERNTSYPWLHIIASVMAWASSVIN 319

  Fly   315 PFIYGIYNEK-------FKREFNKRFAACFCKF-------KTSMDAHERTFSMHTRASS--IRST 363
            |.||...|..       |:..:.|.||  ..||       ..|.:.|:   |.:::..|  ||||
  Fly   320 PIIYAASNRNYSESIFYFRVAYYKIFA--LLKFWGEPLSPMPSRNYHQ---SKNSKELSGVIRST 379

  Fly   364  363
              Fly   380  379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LkrNP_647968.3 7tm_4 46..329 CDD:304433 62/316 (20%)
7tm_1 52..318 CDD:278431 57/292 (20%)
PHA03216 467..>519 CDD:177558
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 57/292 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.