powered by:
Protein Alignment blanks and PRKRA
DIOPT Version :9
Sequence 1: | NP_647966.1 |
Gene: | blanks / 38620 |
FlyBaseID: | FBgn0035608 |
Length: | 324 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003681.1 |
Gene: | PRKRA / 8575 |
HGNCID: | 9438 |
Length: | 313 |
Species: | Homo sapiens |
Alignment Length: | 35 |
Identity: | 12/35 - (34%) |
Similarity: | 18/35 - (51%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 282 TFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKL 316
||:..|.|.:.....||.|||.|:::.:....|.|
Human 65 TFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINIL 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165158116 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.