DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and PRKRA

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_003681.1 Gene:PRKRA / 8575 HGNCID:9438 Length:313 Species:Homo sapiens


Alignment Length:35 Identity:12/35 - (34%)
Similarity:18/35 - (51%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 TFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKL 316
            ||:..|.|.:.....||.|||.|:::.:....|.|
Human    65 TFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINIL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
PRKRANP_003681.1 Sufficient for self-association and interaction with TARBP2 1..103 12/35 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
DSRM_PRKRA_rpt1 32..102 CDD:380718 12/35 (34%)
Sufficient for self-association and interaction with TARBP2 102..195
DSRM_PRKRA_rpt2 126..192 CDD:380720
Sufficient for self-association and interaction with TARBP2 195..313
DSRM_PRKRA_rpt3 239..310 CDD:380721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.