DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Stau1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_445888.1 Gene:Stau1 / 84496 RGDID:621778 Length:495 Species:Rattus norvegicus


Alignment Length:295 Identity:62/295 - (21%)
Similarity:112/295 - (37%) Gaps:80/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AMGGENKSDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKN-KKAKI 110
            ::||: :.:.||.:  .|....|....::|..:::...::..       .|||:.:::| .|::|
  Rat    44 SVGGQ-QFNGKGKM--RPPVKHDATARALRTLQSEPLPERLE-------VNGRESEEENLNKSEI 98

  Fly   111 RPLTMPVTSKDALMVLNELKGVTVDNMQIKRD----HEGKIMARVVVNSKKYEAEGSSVN-SARN 170
            ..: ..:..|..|.|..|...:|    |:.|:    |....:.||.|.....|.||.|.. |.:|
  Rat    99 SQV-FEIALKRNLPVNFESFPLT----QVARESGPPHMKNFVTRVSVGEFVGEGEGKSKKISKKN 158

  Fly   171 AACEKALQEILTTKMKAVLD-----GPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLY 230
            ||             :|||:     .|..::|..:..|.:|  |....||               
  Rat   159 AA-------------RAVLEQLRRLPPLPAVERVKPRIKKK--SQPTCKL--------------- 193

  Fly   231 NDLKNKQTSVVEPKKPLPETWKNMHPCMVLNYMR-------PQCTFIVSGGTGTNQNNTFSMSVC 288
                  ||:        |:..:.|:|...|..::       |:  :::....|..:...|.|.|.
  Rat   194 ------QTA--------PDYGQGMNPISRLAQIQQAKKEKEPE--YMLLTERGLPRRREFVMQVK 242

  Fly   289 VDNCEFNAEGPSKKAARYKLSALVCNKLFGTDYPQ 323
            |.:......|.:||.|: :.:|....::.|...||
  Rat   243 VGHHTAEGAGTNKKVAK-RNAAENMLEILGFKVPQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Stau1NP_445888.1 DSRM_SF 1..70 CDD:412133 6/28 (21%)
DSRM_SF 95..167 CDD:412133 24/89 (27%)
DSRM_STAU1_rpt4 194..279 CDD:380714 20/94 (21%)
Staufen_C 366..475 CDD:374568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.