DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and AT1G01760

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001322030.1 Gene:AT1G01760 / 839252 AraportID:AT1G01760 Length:433 Species:Arabidopsis thaliana


Alignment Length:158 Identity:33/158 - (20%)
Similarity:61/158 - (38%) Gaps:36/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KALSDQITSSMRVTKNKIADDKSSDV--ITDDATNGRKKQKKN---KKAKIRPLTMPVTSKDALM 124
            |..|.|:..|:.|..:.|...:.|||  |..::..|...|..:   :|......|:.|:..|.:.
plant   174 KIPSTQVDDSLLVQASDICSSRHSDVPEIGSNSNKGNGSQVADMVQRKPGRGETTLSVSCSDKIA 238

  Fly   125 VLNELKGVTVDNMQIKRDHEGKIMARVVVNSKKYEAE---GSSVNSARNAACEKALQEILTTKMK 186
            ..|.| ||           :|.::.:|:  ...|.:.   |.|::|..|.:....|:..|..::.
plant   239 RWNVL-GV-----------QGALLYQVL--QPVYISTITVGQSLHSPDNFSLADHLRRSLYERIL 289

  Fly   187 AVLDGPGKSLESDEDDILEKMASYAIHK 214
            .:.|              |.:.|:.::|
plant   290 PLSD--------------ELLTSFRLNK 303



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10910
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.