DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Adar

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006232836.1 Gene:Adar / 81635 RGDID:71099 Length:1183 Species:Rattus norvegicus


Alignment Length:337 Identity:75/337 - (22%)
Similarity:106/337 - (31%) Gaps:107/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLADNLKKTAMGGENKSD-EKGTVSSE---PKALSDQITSSMRVTKNKIAD-----DKSSDVITD 93
            |.|.|..|....||...| |.|..:|:   |..|.|     |...|.||.|     .|||     
  Rat   218 PRAVNSDKEVPRGEPDLDSEDGDPASDLEGPSELLD-----MAEIKEKICDYLFNVSKSS----- 272

  Fly    94 DATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNEL--------KGVTV----------DNMQIK 140
             |.|..|.....|            ::|...||.:|        :|.|.          :.:|:|
  Rat   273 -ALNLAKNIGLAK------------ARDVNAVLIDLERQGDVYREGATPPIWYLTDKKRERLQMK 324

  Fly   141 RD-HEGKIMARVVVNSKKYEA---------EGSSVNSARNAACEKALQEILT------------- 182
            |. |.|.......|:......         .|.|.:.|.:...|.. ||.:|             
  Rat   325 RSTHSGPAATPAAVSEATQSTSFPTCHPPQSGGSSSMATSKRVENG-QEPVTKYESRHEARPGPV 388

  Fly   183 -TKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDI-----DVATLYNDLK--NKQTS 239
             .:..|..:||.:             |.|...:.| .|.||||     .:.|...:.:  .:..|
  Rat   389 RLRPHAYHNGPSR-------------AGYVASENG-PWATDDIPDNLNSIHTAPGEFRAIMEMPS 439

  Fly   240 VVEPKKPLPETWKNMHPCMVLN----------YMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEF 294
            ...|..|....:|.:..|.:.|          :....|.|.:...:|.:....|...|.::..||
  Rat   440 FYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPSHEPRFKFQVVINGREF 504

  Fly   295 -NAEGPSKKAAR 305
             .||..|||.|:
  Rat   505 PPAEAGSKKVAK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
AdarXP_006232836.1 z-alpha 145..211 CDD:280459
z-alpha 253..317 CDD:295419 19/86 (22%)
DSRM 462..527 CDD:214634 13/55 (24%)
DSRM 573..639 CDD:214634
DSRM 681..746 CDD:214634
ADEAMc 793..1176 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.