DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Adad2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_038954126.1 Gene:Adad2 / 691275 RGDID:1586236 Length:561 Species:Rattus norvegicus


Alignment Length:218 Identity:39/218 - (17%)
Similarity:81/218 - (37%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQLLAESCAKVDILEMKKALIPNPSAEEDAVAVIPLADNLKKTAMGGENKSDEKGTVSSEPKALS 68
            :::..|:|..::    ...|.|.|:.:      .|:|  |:..::..::.|      .::..||.
  Rat    52 QEVHGEACKALE----GSVLSPGPAGD------FPMA--LRGLSLLPKDPS------PAQAMALL 98

  Fly    69 DQITSSMRVT----KNKIADDKSS-------DVITDDATNGRKKQKKNKKAKI-------RPLTM 115
            .|..:::.|:    :::.||..||       |.:...|..|..|.:..::|.:       :.|..
  Rat    99 TQYMANLGVSLTFLEDQTADPGSSFSVCAELDGLVCPAGTGSSKLEAKQQAALSALQYIQKQLER 163

  Fly   116 P---VTSKDALMVLNELKGVTVDNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKAL 177
            |   ||.:..|:....::.:..        ||.:..|.|.....:..:|.|...:.:.......|
  Rat   164 PELLVTPRQPLLTSLSIETILT--------HEQRCAAVVSAGLDRLLSENSPYRACKGTVAAVVL 220

  Fly   178 QEILTTKMKAVLDGPGKSLESDE 200
            :       :.|....|.|.|:.|
  Rat   221 E-------REVQGSIGHSKETYE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Adad2XP_038954126.1 DSRM_SF 91..157 CDD:412133 13/65 (20%)
A_deamin 239..554 CDD:396626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.