DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and zfr2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_005161660.1 Gene:zfr2 / 567465 ZFINID:ZDB-GENE-070705-184 Length:1004 Species:Danio rerio


Alignment Length:295 Identity:51/295 - (17%)
Similarity:105/295 - (35%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIP--NPSAEEDA------VAVIPLADNLKKTAMGGENKSDEKGTVSSEPKALSDQITSSMRVTK 79
            |:|  .|.:.:|.      .|:.|:.:.|:..          :..||...:||  ::.|...:.|
Zfish   645 LLPVRRPDSPDDRHIMAKHSAIYPVEEELQAV----------QRIVSHSERAL--KLVSDTLLEK 697

  Fly    80 NKIADDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDAL--------MVLNELKGVTVDN 136
            ...|||..|:  ||..:   :.|.:..|..:|   :.:.:|..|        ::|......||..
Zfish   698 VACADDDESE--TDKQS---ETQSRTLKGVMR---VGILAKGLLLRGDRNVQLILLAANKPTVSL 754

  Fly   137 MQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDED 201
            ::...:...|.:|....:..:.:......|....::.|..:|..::.....:.:.|..::|    
Zfish   755 LKTVAEQLPKQLATFSEDQYEVQVHPEEANIVIFSSKEPKMQVTISLTSPVMREDPVPNME---- 815

  Fly   202 DILEKMASYAIHKLGEEWKTDDIDVATLYNDLK-NKQTSVVEPKKPLPETWKNMHPC-MVLNYMR 264
                              |..:.|...|.|.:| .:..:.:...|........:..| :::..:|
Zfish   816 ------------------KVSEKDPPDLLNRIKCLEYLAALRHAKWFQARANGLQSCVIIIRVLR 862

  Fly   265 PQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGP 299
            ..|..|.:.|...|    ::|.:.|:....:|.||
Zfish   863 DLCQRIPTWGKMPN----WAMELIVEKAISSASGP 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
zfr2XP_005161660.1 ZnF_U1 313..342 CDD:197732
C2H2 Zn finger 315..337 CDD:275371
ZnF_U1 358..392 CDD:197732
C2H2 Zn finger 363..385 CDD:275371
ZnF_U1 524..555 CDD:197732
C2H2 Zn finger 527..549 CDD:275371
DZF 718..968 CDD:128842 31/205 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.