DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Adar

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001344887.1 Gene:Adar / 56417 MGIID:1889575 Length:1217 Species:Mus musculus


Alignment Length:308 Identity:62/308 - (20%)
Similarity:105/308 - (34%) Gaps:59/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PNPSAEEDAVAVIPLADNLKKTAMGGENKSDEK-GTVSSEPKALSDQITSSMRVTKNK---IADD 85
            |.|:....:||.....:|.::.|:..|::.:.: |.:...|.|..:..:.:..|....   ..||
Mouse   386 PPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGYVASENGQWATDD 450

  Fly    86 KSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSK-------------DALMVLNELKGVTVDNM 137
            ...::.:.....|..:......:...| |:|..|.             ..|:...:....|.|..
Mouse   451 IPDNLNSIHTAPGEFRAIMEMPSFYSP-TLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFN 514

  Fly   138 QIKR---DHEGKIMARVVVNSKKY-EAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSL-- 196
            .|::   .||.:...:||:|.::: .||..|...|:..|..||: .||..:.||...|..:.|  
Mouse   515 LIEQSGPSHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAVKAM-AILLREAKAKDSGQPEDLSH 578

  Fly   197 ---ESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKNMHPCM 258
               |.|.:...|..|.                        .:..||:...|.|:....:.||.  
Mouse   579 CPMEEDSEKPAEAQAP------------------------SSSATSLFSGKSPVTTLLECMHK-- 617

  Fly   259 VLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEF-NAEGPSKKAAR 305
                :...|.|.:....|...:..|...|.|....| ....||||.|:
Mouse   618 ----LGNSCEFRLLSKEGPAHDPKFQYCVAVGAQTFPPVSAPSKKVAK 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
AdarNP_001344887.1 z-alpha 176..242 CDD:280459
z-alpha 287..351 CDD:295419
DSRM 496..561 CDD:214634 16/65 (25%)
DSRM 607..673 CDD:214634 15/61 (25%)
DSRM 715..780 CDD:214634
ADEAMc 827..1210 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.