DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and adarb2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_686426.5 Gene:adarb2 / 558149 ZFINID:ZDB-GENE-060503-160 Length:740 Species:Danio rerio


Alignment Length:308 Identity:71/308 - (23%)
Similarity:120/308 - (38%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NKSDEKGTVSSEPKALSDQITSSMRVTKNK----------IADDKSSDVITD---DATNGRKKQK 103
            |.::::.|:|          |||..|.:|:          :..|..:...:|   |..:|.|:::
Zfish    45 NGTEDEDTLS----------TSSAEVKENRNTGNLEDCAIVTSDCQTLFFSDSPRDGASGLKRKR 99

  Fly   104 ---KNKKAKIRPLTM-------PVTSKDALMVLNELKGVTVDNM--QIKRDHEGKIMARVVVNSK 156
               ::....:|.|.:       ....|:||:.||||:......|  |....|.......|.||..
Zfish   100 PLEEDNNGHLRKLRLYCKKLAWSDAPKNALVQLNELRPGLQYRMVSQTGPVHAPLFSIAVEVNGL 164

  Fly   157 KYEAEGSSVNSARNAACEKALQEIL----TTKMKAVLDG---PGKSLESDEDDILEKMASYAIHK 214
            .:|..|.:...|:..|.|.||:..:    .::....:.|   |.....||:.|..:        .
Zfish   165 TFEGTGPTKKKAKMKAAEMALKSFIQFPNASQAHLAMGGLSNPTADFTSDQADFPD--------T 221

  Fly   215 LGEEWKTDDIDVA---TLYNDLKNKQT---SVVEPKK------PLPETWKNMHPCMVLNYMRPQC 267
            |.:.::.|....|   .|.:.|:.:.|   .||:.::      |.|.:.....|.::||.:||..
Zfish   222 LFKGFEPDGCRSAENELLSSALRLRHTLDLMVVQARQEDPCLPPAPVSPPQPSPVVLLNDLRPGL 286

  Fly   268 TF--IVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSALVC 313
            .:  :.....|...:.:|.|:|.||...|...|.|||.|  |..|.||
Zfish   287 RYACLSEHAQGKRAHRSFIMAVRVDGRIFEGSGRSKKQA--KRQAAVC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
adarb2XP_686426.5 DSRM 125..>172 CDD:214634 15/46 (33%)
dsrm 278..337 CDD:278464 20/57 (35%)
ADEAMc 364..737 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.