DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and prkra

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_005172565.1 Gene:prkra / 557370 ZFINID:ZDB-GENE-050309-206 Length:289 Species:Danio rerio


Alignment Length:210 Identity:44/210 - (20%)
Similarity:75/210 - (35%) Gaps:71/210 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LTM-PVTSKD--ALMVLNELKGVTVDNMQ----IKRD---HEGKIMARVVVNSKKYEAEGSSVNS 167
            :|| |..|:|  .:.:|:|. |:.:.:..    |..|   |:...|..|.:.....:..||:..:
Zfish     6 VTMAPQRSQDKTPIQLLHEY-GIKISSAPKYELIHADGDAHQPSFMFSVTIGEVTCKGRGSTKKA 69

  Fly   168 ARNAACEKALQEILTTKMKAVL---DGPGKSLESDEDD----ILEKMASYAIHKLGEEWKTDDID 225
            |::.|.|.||:  |..:...::   |..|.|.|:.|..    ||:::|...:      |      
Zfish    70 AKHEAAEAALK--LLKRDSQIIDQRDNNGLSPEAGEASNPVGILQELAMQRV------W------ 120

  Fly   226 VATLYNDLKNKQTSVVEPKKPLPETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVD 290
                                .|||                   ::|...||......|:::..::
Zfish   121 --------------------CLPE-------------------YVVFMETGPGHMKEFTIACRLE 146

  Fly   291 NCEFNAEGPSKKAAR 305
            ..|....|.|||.||
Zfish   147 GLEETGSGSSKKLAR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
prkraXP_005172565.1 DSRM 18..>66 CDD:214634 9/48 (19%)
DSRM 106..172 CDD:238007 18/107 (17%)
Staufen_C 197..266 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.