DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and STRBP

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_016870379.1 Gene:STRBP / 55342 HGNCID:16462 Length:674 Species:Homo sapiens


Alignment Length:274 Identity:68/274 - (24%)
Similarity:110/274 - (40%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKNKKAKIRPL--TMP 116
            :|::|..||..|          |..::.:.|||..:          ||.|:|    :|.:  :..
Human   345 TDKEGAGSSALK----------RPFEDGLGDDKDPN----------KKMKRN----LRKILDSKA 385

  Fly   117 VTSKDALMVLNELKGVTVDNMQIK-RDHEGKIMARVV-----VNSKKYEAEGSSVNSARNAACEK 175
            :...:|||.||:::    ..:|.| ....|.:.|.|.     |:...|||.|.|..:|:.....|
Human   386 IDLMNALMRLNQIR----PGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVK 446

  Fly   176 ALQEI-LTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTS 239
            .||.: ..|...|.::......:||.:...|.::|.:.:..|.             :..:...|.
Human   447 VLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSSNNTGN-------------STTETSSTL 498

  Fly   240 VVEPKKP-LPETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKA 303
            .|..:.| |..:.||  |.|.||..|....:.:...||.:.:..|.|.|.||..:|...||:||.
Human   499 EVRTQGPILTASGKN--PVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRGAGPNKKV 561

  Fly   304 ARYKLSALVCNKLF 317
            |:...:.....|||
Human   562 AKASAALAALEKLF 575



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.