DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and stau2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_021325790.1 Gene:stau2 / 393899 ZFINID:ZDB-GENE-040426-687 Length:684 Species:Danio rerio


Alignment Length:217 Identity:45/217 - (20%)
Similarity:87/217 - (40%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KDALMVLNELKGVTVDNMQIKRDHE-----GKIM-ARVVVNSKKYEAEGSSVNSARNAACEKALQ 178
            |..:.::|||........|.|..:|     .||. .::.:.::.:|:||||:..|:::...|||.
Zfish    79 KTPMCLVNELARFNRIQPQYKLLNEKGPAHAKIFTVQLCLGNQVWESEGSSIKKAQHSTATKALA 143

  Fly   179 EILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEP 243
            |      .::...|.:|.::|.:.....:             |..:::..|  .:|..:.::..|
Zfish   144 E------SSLPRPPPRSPKADSNSNPGSI-------------TPTVELNGL--AMKRGEPAIYRP 187

  Fly   244 --KKPLPETWKNMHPCMVLN----YMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKK 302
              .||:|....|.:...:.|    |..|:               .|.:.:.|.|.||..||.:::
Zfish   188 LDPKPIPNYRANYNFRGMFNQRYHYPVPK---------------VFYVQLTVGNNEFIGEGRTRQ 237

  Fly   303 AARYKLSALVCNKLFGTDYPQK 324
            |||:..:......|.....|::
Zfish   238 AARHNAAMKALQALKNEPIPER 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
stau2XP_021325790.1 DSRM 81..142 CDD:214634 15/60 (25%)
DSRM 168..252 CDD:214634 20/100 (20%)
DSRM 281..345 CDD:214634
DSRM 380..446 CDD:214634
Staufen_C 526..631 CDD:318642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.