DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and tarbp2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_956291.1 Gene:tarbp2 / 336141 ZFINID:ZDB-GENE-030131-8085 Length:346 Species:Danio rerio


Alignment Length:249 Identity:54/249 - (21%)
Similarity:88/249 - (35%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNEL-----KGVTVDNMQIK-RD 142
            |:||.|       ||:   :.:....|..:......|..:.:|.|.     |....|.::.: :.
Zfish     3 DEKSQD-------NGK---RNSGYTSIEQMLAVNPGKTPISLLQEYGTRIGKTPVYDLLKAEGQA 57

  Fly   143 HEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDEDDILEKM 207
            |:.....||.|........|.|..:|::.|.|.|| ::|...|...:.|.|  :|.|        
Zfish    58 HQPNFTFRVSVGDINCTGHGPSKKAAKHKAAEAAL-KMLKGGMLGGIGGNG--MEGD-------- 111

  Fly   208 ASYAIHKLGE----EWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKNMHPCMVLNYMRPQCT 268
            ....|...||    |.|:.........|.:...|..||:....|||                   
Zfish   112 GFVGIEMEGECPQSEMKSSSSTQQAECNPVGALQELVVQKGWRLPE------------------- 157

  Fly   269 FIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLFGTDYP 322
            :.|:..:|......|:|:..|:.......|.|||.|:...:|.:.:::.  |.|
Zfish   158 YTVTQESGPAHRKEFTMTCRVERFVEIGSGTSKKLAKRNAAAKMLSRIH--DVP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
tarbp2NP_956291.1 DSRM 31..>79 CDD:214634 9/47 (19%)
DSRM 139..202 CDD:238007 18/81 (22%)
Staufen_C <278..325 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.