DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ilf3a

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001025236.1 Gene:ilf3a / 324431 ZFINID:ZDB-GENE-030131-3151 Length:820 Species:Danio rerio


Alignment Length:262 Identity:61/262 - (23%)
Similarity:104/262 - (39%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DQITS-SMRVTKNKIAD---DKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNEL 129
            |::|| :.|:.::::.|   .:..:.......:.|.|..:.::.|..|        :|||.||:|
Zfish   413 DRLTSKAARMIEHRVPDPPIKRPRESFDGGDFDTRLKFPRKEERKEPP--------NALMKLNQL 469

  Fly   130 KGVTVDNM--QIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGP 192
            :..||..:  |...:||.:....|.|:...|||.|.|..||:....:|.|..:            
Zfish   470 RPGTVYKLASQTGPEHEPQFSMTVEVDGVTYEATGPSKRSAKLHVAQKVLVAL------------ 522

  Fly   193 GKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKN-MHP 256
            |..|.|:.             |..||.|:..:.........:|..|...:..:..|...|: .:|
Zfish   523 GVPLPSET-------------KPAEEKKSQSVSTPAATASSENTPTGSDDGAEGGPILTKHGKNP 574

  Fly   257 CMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLFGTDY 321
            .|.||..|....:.:....|...:.||::.|.||..:|...|.:||.|:...:.....:||....
Zfish   575 VMELNEKRRSLKYELVSVKGRFNDKTFTIEVDVDGQKFQGSGSNKKLAKANAALAALEQLFPNCP 639

  Fly   322 PQ 323
            |:
Zfish   640 PE 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ilf3aNP_001025236.1 DZF 165..418 CDD:295427 2/4 (50%)
DSRM 459..523 CDD:214634 23/83 (28%)
DSRM 572..>622 CDD:214634 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.