DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and zfr

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_955852.2 Gene:zfr / 321659 ZFINID:ZDB-GENE-030131-378 Length:1074 Species:Danio rerio


Alignment Length:148 Identity:35/148 - (23%)
Similarity:55/148 - (37%) Gaps:35/148 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNELKGVTVDNMQIKRDHE-------- 144
            ||:|||.......|.|:..|.|..|      .||.|:......||....:.::.|.|        
Zfish   754 SDIITDQDAGASAKGKEEDKEKKEP------PKDRLLKGVMRVGVLAKGLLLRGDKEVNLVLLCS 812

  Fly   145 ----GKIMARVV---------VNSKKYEAEGSSVNSA-RNAACEKALQEILTTKMKAVL------ 189
                ..::.|:|         |..:|||.:||...|| ...:|.....::..|....::      
Zfish   813 EKPTKNLLTRIVEHLPKQLTMVTPEKYEVKGSIQESAIILTSCGDPKMQVTITLTSPIIREESSR 877

  Fly   190 DGP-GKSLESDEDDILEK 206
            ||. ..|:..|..|:|::
Zfish   878 DGDVTSSMVKDPADVLDR 895

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
zfrNP_955852.2 ZnF_U1 324..353 CDD:197732
C2H2 Zn finger 326..348 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..374
ZnF_U1 380..409 CDD:197732
C2H2 Zn finger 380..402 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..545
ZnF_U1 575..606 CDD:197732
C2H2 Zn finger 578..600 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..718
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 761..781 5/25 (20%)
DZF 784..1037 CDD:128842 22/112 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1036..1074
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.