DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Adar

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001368969.1 Gene:Adar / 31130 FlyBaseID:FBgn0026086 Length:681 Species:Drosophila melanogaster


Alignment Length:230 Identity:58/230 - (25%)
Similarity:90/230 - (39%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KNKKAKIRPLTMPVTSKDALMVLNELKGVTVDNMQIKRD--HEGKIMARVVVNSKKYEAEGSSVN 166
            |.|..|.| :..|   |:.:.:||||:...:..::.:..  |.......|.|:.:||..:|.|..
  Fly    93 KKKMCKER-IPQP---KNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKK 153

  Fly   167 SARNAACEKALQEILTTKMKAVLD--GPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATL 229
            .||..|...||:..:..|..|||.  .|..:|:...|:.||                        
  Fly   154 VARIEAAATALRSFIQFKDGAVLSPLKPAGNLDFTSDEHLE------------------------ 194

  Fly   230 YNDLKNKQTSVVEPKKPLPETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEF 294
             ||: :|....|:.:|.:|:    ..|.|:|..:.....|......|...|..|.|:|.::..:|
  Fly   195 -NDV-SKSAITVDGQKKVPD----KGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKKF 253

  Fly   295 NAEGPSKKAARYKLSALVCNKLFGTDY-----PQK 324
            :..|||||.|:...:......|....|     |||
  Fly   254 DGTGPSKKTAKNAAAKAALASLCNISYSPMVVPQK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
AdarNP_001368969.1 DSRM_STRBP_RED-like_rpt1 105..167 CDD:380694 17/61 (28%)
DSRM_SF 213..>259 CDD:412133 11/45 (24%)
ADEAMc 306..677 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.