DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Adat1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_038953.1 Gene:Adat1 / 30947 MGIID:1353631 Length:499 Species:Mus musculus


Alignment Length:188 Identity:42/188 - (22%)
Similarity:66/188 - (35%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGP-----GKSLESDED 201
            :.|..::|.||           .:.::.|.||:...:|:..|| :.|..|.     |:|...:..
Mouse    28 NREWTLLAAVV-----------KIQASANQACDIPEKEVQVTK-EVVSMGTGTKCIGQSKMRESG 80

  Fly   202 DIL----------EKMASYAIHK--LGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKNM 254
            |||          .....|.:|:  |....|.|.|.|       ...|..:...:..|...:.:.
Mouse    81 DILNDSHAEIIARRSFQRYLLHQLHLAAVLKEDSIFV-------PGTQRGLWRLRPDLSFVFFSS 138

  Fly   255 H-PC-------MVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVD--NCEFNAEGPSKK 302
            | ||       |:....:|.|..|.|....:....|.::....|  |||..|...:||
Mouse   139 HTPCGDASIIPMLEFEEQPCCPVIRSWANNSPVQETENLEDSKDKRNCEDPASPVAKK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Adat1NP_038953.1 A_deamin 63..492 CDD:280326 31/141 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..194 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.