DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Stau2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_079579.2 Gene:Stau2 / 29819 MGIID:1352508 Length:570 Species:Mus musculus


Alignment Length:189 Identity:41/189 - (21%)
Similarity:69/189 - (36%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 HEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDEDDILEKM 207
            |......::.:..:.:|:||||:..|:.|...|||.|  :|..|.|...|..::.::...|    
Mouse    36 HSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTE--STLPKPVQKPPKSNVNNNPGSI---- 94

  Fly   208 ASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKNMHPCMVLNY-------MRP 265
                         |..:::..|  .:|..:.::..|..|.|      .|....||       .|.
Mouse    95 -------------TPTVELNGL--AMKRGEPAIYRPLDPKP------FPNYRANYNFRGMYNQRY 138

  Fly   266 QCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLFGTDYPQK 324
            .|.          ....|.:.:.|.|.||..||.:::|||:..:......|.....|:|
Mouse   139 HCP----------MPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPEK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Stau2NP_079579.2 DSRM_STAU2_rpt1 3..70 CDD:380709 9/33 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..94 5/24 (21%)
DSRM_STAU2_rpt2 98..179 CDD:380711 20/98 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..203 3/10 (30%)
DSRM_STAU2_rpt3 206..272 CDD:380713
Nuclear localization signal 1 273..291
DSRM_STAU2_rpt4 304..389 CDD:380715
Nuclear localization signal 2. /evidence=ECO:0000250 373..412
Required for dendritic transport. /evidence=ECO:0000250 381..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..413
Staufen_C 465..523 CDD:374568
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.