DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and STAU2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001157852.1 Gene:STAU2 / 27067 HGNCID:11371 Length:570 Species:Homo sapiens


Alignment Length:218 Identity:47/218 - (21%)
Similarity:79/218 - (36%) Gaps:50/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KDALMVLNELKGVTVDNMQIK------RDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQ 178
            |.|:.::|||........|.|      ..|......::.:..:.:|:||||:..|:.|...|||.
Human     7 KTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKALT 71

  Fly   179 EILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEP 243
            |  :|..|.|...|..::.::...|                 |..:::..|  .:|..:.::..|
Human    72 E--STLPKPVQKPPKSNVNNNPGSI-----------------TPTVELNGL--AMKRGEPAIYRP 115

  Fly   244 KKPLPETWKNMHPCMVLNY-------MRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSK 301
            ..|.|      .|....||       .|..|..          ...|.:.:.|.|.||..||.::
Human   116 LDPKP------FPNYRANYNFRGMYNQRYHCPV----------PKIFYVQLTVGNNEFFGEGKTR 164

  Fly   302 KAARYKLSALVCNKLFGTDYPQK 324
            :|||:..:......|.....|::
Human   165 QAARHNAAMKALQALQNEPIPER 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
STAU2NP_001157852.1 DSRM 9..70 CDD:214634 15/60 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..94 5/24 (21%)
DSRM 96..180 CDD:214634 20/101 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..203 1/7 (14%)
DSRM 209..273 CDD:214634
Nuclear localization signal 1. /evidence=ECO:0000250 273..291
DSRM 308..374 CDD:214634
Nuclear localization signal 2. /evidence=ECO:0000250 373..412
Required for dendritic transport. /evidence=ECO:0000250 381..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..409
Staufen_C 459..523 CDD:318642
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.