DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Adarb1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006256337.1 Gene:Adarb1 / 25367 RGDID:2033 Length:775 Species:Rattus norvegicus


Alignment Length:256 Identity:62/256 - (24%)
Similarity:110/256 - (42%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNELKGVTVDNMQIKRD---HEGKIMARVVVN 154
            ::.:||..|.:..|:   |....||..|:|||.|||:| ..:..|.:.:.   |....:..|.||
  Rat   120 EEGSNGHSKYRLKKR---RKTPGPVLPKNALMQLNEIK-PGLQYMLLSQTGPVHAPLFVMSVEVN 180

  Fly   155 SKKYEAEGSSVNSARNAACEKALQEIL--TTKMKAVLDGPGKSLE------SDEDDILEKMAS-- 209
            .:.:|..|.:...|:..|.||||:..:  ....:|.| ..|::|.      ||:.|..:.:.:  
  Rat   181 GQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHL-AMGRTLSVNTDFTSDQADFPDTLFNGF 244

  Fly   210 ---------YAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETW---KNMHPCMVLNY 262
                     :.:...|::..:...||:...:.:   ..|:.:|..|:|..:   ...:|.|:||.
  Rat   245 ETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPV---PASLTQPPLPIPPPFPPPSGKNPVMILNE 306

  Fly   263 MRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLFGTDYPQ 323
            :||...:.....:|.:...:|.|||.||...|...|.:||.|:.:.:......:|.....|
  Rat   307 LRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLDQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Adarb1XP_006256337.1 DSRM 143..206 CDD:238007 21/63 (33%)
DSRM 299..357 CDD:238007 18/57 (32%)
ADEAMc 386..772 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10910
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.