DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ADAT1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001311374.1 Gene:ADAT1 / 23536 HGNCID:228 Length:502 Species:Homo sapiens


Alignment Length:229 Identity:39/229 - (17%)
Similarity:87/229 - (37%) Gaps:66/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAESCAKVDILEMKKALIPNPSAEEDAVAVIPLADNLKKTAMGGENKSDEKGTVSSEPKALSDQI 71
            :|:.|.:...:.:.|...|.|:.|...:|.:          :..::.:|:......:|..::.::
Human     7 IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAV----------VKIQSPADKACDTPDKPVQVTKEV 61

  Fly    72 TS---------SMRVTKN-KIADDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSK-DALMV 125
            .|         ..::.|| .|.:|..::||.         ::..::..:..|.:..|.| |::.|
Human    62 VSMGTGTKCIGQSKMRKNGDILNDSHAEVIA---------RRSFQRYLLHQLQLAATLKEDSIFV 117

  Fly   126 LNELKGVTVDNMQIKRDHEGKIMARVVVNSKKYEAEGSSV---------------NSARNAACEK 175
            ....|||    .:::||     :..|..:|.....:.|.:               |.|.|::.|.
Human   118 PGTQKGV----WKLRRD-----LIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEA 173

  Fly   176 ALQEILTTKMKAVLDGPGKSLESDEDD--ILEKM 207
            :          :.|:.||...:.::.|  :.:||
Human   174 S----------SNLEAPGNERKCEDPDSPVTKKM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ADAT1NP_001311374.1 A_deamin 63..495 CDD:307992 30/163 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..194 4/29 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.