DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ZFR2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011526133.1 Gene:ZFR2 / 23217 HGNCID:29189 Length:940 Species:Homo sapiens


Alignment Length:286 Identity:51/286 - (17%)
Similarity:97/286 - (33%) Gaps:109/286 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SDVITDDATNGRKKQKKNKKAKIRPLT--------MPVTSKDALM-------------------- 124
            ||.:.:: ..||::::.:|::.:.|.|        :.:.:|..|:                    
Human   625 SDTLAEE-DRGRREEEGDKRSSVAPQTRVLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSL 688

  Fly   125 -------VLNELKGVTVDNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEK-ALQEIL 181
                   :..:|:.||.|..::..|.|    |.:|::|                 ||: .:|..:
Human   689 LRRIAQQLPRQLQMVTEDEYEVSSDPE----ANIVISS-----------------CEEPRMQVTI 732

  Fly   182 TTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKP 246
            :.....:.:.|    .:|.:.:             ||.:.|..|              |:.|||.
Human   733 SVTSPLMREDP----STDPEGV-------------EEPQADAGD--------------VLSPKKC 766

  Fly   247 LPE-------TW-----KNMHPC-MVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEG 298
            |..       .|     ..:.|| :|:..:|..|..:.:.|.    ...::|.:.|:....:|.|
Human   767 LESLAALRHARWFQARASGLQPCVIVIRVLRDLCRRVPTWGA----LPAWAMELLVEKAVSSAAG 827

  Fly   299 P--SKKAARYKLSALVCNKLFGTDYP 322
            |  ...|.|..|..:....|. ||.|
Human   828 PLGPGDAVRRVLECVATGTLL-TDGP 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ZFR2XP_011526133.1 ZnF_U1 271..300 CDD:197732
C2H2 Zn finger 273..295 CDD:275371
ZnF_U1 318..350 CDD:197732
C2H2 Zn finger 321..343 CDD:275371
ZnF_U1 467..498 CDD:197732
C2H2 Zn finger 470..492 CDD:275371
DZF 652..905 CDD:128842 44/258 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.