DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Zfr

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006520120.1 Gene:Zfr / 22763 MGIID:1341890 Length:1082 Species:Mus musculus


Alignment Length:224 Identity:46/224 - (20%)
Similarity:73/224 - (32%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMV 125
            |:||..:| |.|||...:.:|.....||    ..|:|..........:.::.|:....|.     
Mouse   430 STEPNVVS-QATSSTAASASKPTASPSS----IGASNCTLNTSSIATSSVKGLSTTGNSS----- 484

  Fly   126 LNELKGVTVD----NMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMK 186
            ||......|.    ||..|:....||.   .|...|.::.|:.....:...|.|........::.
Mouse   485 LNSTSNTKVSAIPTNMAAKKTSTPKIN---FVGGNKLQSTGNKTEDLKGIDCVKNTPAASAVQIP 546

  Fly   187 AVLDGPGK---------SLESDEDDILEKMASYAIHKLGEEWKTDDIDVATL--------YND-- 232
            .|....|.         :|:||...:        .|...||.:.|:..|...        :||  
Mouse   547 EVKQDAGSEPVTPASLAALQSDVQPV--------GHDYVEEVRNDEGKVIRFHCKLCECSFNDPN 603

  Fly   233 -----LKNKQTSVVEPKKPLPETWKNMHP 256
                 ||.::..:...||..|:....:.|
Mouse   604 AKEMHLKGRRHRLQYKKKVNPDLQVEVKP 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ZfrXP_006520120.1 ZnF_U1 339..368 CDD:197732
C2H2 Zn finger 341..363 CDD:275371
PHA03255 390..>559 CDD:165513 30/141 (21%)
ZnF_U1 392..421 CDD:197732
C2H2 Zn finger 392..414 CDD:275371
ZnF_U1 589..620 CDD:197732 4/30 (13%)
C2H2 Zn finger 592..614 CDD:275371 4/21 (19%)
DZF 792..1046 CDD:128842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.