| Sequence 1: | NP_647966.1 | Gene: | blanks / 38620 | FlyBaseID: | FBgn0035608 | Length: | 324 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_033345.2 | Gene: | Tarbp2 / 21357 | MGIID: | 103027 | Length: | 365 | Species: | Mus musculus |
| Alignment Length: | 195 | Identity: | 42/195 - (21%) |
|---|---|---|---|
| Similarity: | 65/195 - (33%) | Gaps: | 61/195 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 143 HEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDEDDILEKM 207
Fly 208 ASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVV--EPKKPLPETWKNMHPCMVLNYMRP----- 265
Fly 266 --QCT------------------FIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSA 310
Fly 311 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| blanks | NP_647966.1 | None | |||
| Tarbp2 | NP_033345.2 | Sufficient for interaction with PRKRA. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 | 22..105 | 16/60 (27%) | |
| DSRM_TARBP2_rpt1 | 27..98 | CDD:380719 | 13/49 (27%) | ||
| Sufficient for interaction with PRKRA. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 | 151..233 | 12/68 (18%) | |||
| DSRM_TARBP2_rpt2 | 158..224 | CDD:380681 | 11/61 (18%) | ||
| Sufficient for interaction with DICER1. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 | 227..365 | ||||
| Sufficient for interaction with PRKRA. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 | 286..365 | ||||
| DSRM_TARBP2_rpt3 | 291..362 | CDD:380722 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167848507 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||