DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Stau1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001103376.1 Gene:Stau1 / 20853 MGIID:1338864 Length:495 Species:Mus musculus


Alignment Length:302 Identity:60/302 - (19%)
Similarity:111/302 - (36%) Gaps:94/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AMGGENKSDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKN-KKAKI 110
            ::||: :.:.||.:  .|....|....::|..:::...::..       .|||:.:::| .|::|
Mouse    44 SVGGQ-QFNGKGKM--RPPVKHDAPARALRTLQSEPLPERLE-------VNGREAEEENLNKSEI 98

  Fly   111 RPL-------TMPVTSKDALMVLNELKGVTVDNMQIKRD----HEGKIMARVVVNSKKYEAEGSS 164
            ..:       .:||..:..|:.            |:.|:    |....:.||.|.....|.||.|
Mouse    99 SQVFEIALKRNLPVNFESFLLT------------QVARESGPPHMKNFVTRVSVGEFVGEGEGKS 151

  Fly   165 VN-SARNAACEKALQEILTTKMKAVLD-----GPGKSLESDEDDILEKMASYAIHKLGEEWKTDD 223
            .. |.:|||             :|||:     .|..::|..:..|.:|  |....||        
Mouse   152 KKISKKNAA-------------RAVLEQLRRLPPLPAVERVKPRIKKK--SQPTCKL-------- 193

  Fly   224 IDVATLYNDLKNKQTSVVEPKKPLPETWKNMHPCMVLNYMR-------PQCTFIVSGGTGTNQNN 281
                         ||:        |:..:.|:|...|..::       |:  :::....|..:..
Mouse   194 -------------QTA--------PDYGQGMNPISRLAQIQQAKKEKEPE--YMLLTERGLPRRR 235

  Fly   282 TFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLFGTDYPQ 323
            .|.|.|.|.:......|.:||.|: :.:|....::.|...||
Mouse   236 EFVMQVKVGHHTAEGVGTNKKVAK-RNAAENMLEILGFKVPQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Stau1NP_001103376.1 DSRM 98..167 CDD:214634 21/93 (23%)
DSRM 204..270 CDD:238007 13/68 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..318
Staufen_C 366..475 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.