DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Strbp

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011237345.1 Gene:Strbp / 20744 MGIID:104626 Length:678 Species:Mus musculus


Alignment Length:277 Identity:70/277 - (25%)
Similarity:103/277 - (37%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVT 118
            :|::|..||..|          |..::.:.|||..:          ||.|:|.: ||.. :..:.
Mouse   345 TDKEGAGSSALK----------RPFEDGLGDDKDPN----------KKMKRNLR-KILD-SKAID 387

  Fly   119 SKDALMVLNELKGVTVDNMQIK-RDHEGKIMARVV-----VNSKKYEAEGSSVNSARNAACEKAL 177
            ..:|||.||:::    ..:|.| ....|.:.|.|.     |:...|||.|.|..:|:.....|.|
Mouse   388 LMNALMRLNQIR----PGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVL 448

  Fly   178 QEILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVE 242
            |.:   ......|...:.:.|||             |...|.|.|.:.    .|...|...|..|
Mouse   449 QAM---GYPTGFDADIECISSDE-------------KSDNESKNDTVS----SNSSNNTGNSTTE 493

  Fly   243 PKKPLPE-------TWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPS 300
            ....|..       |....:|.|.||..|....:.:...||.:.:..|.|.|.||..:|...||:
Mouse   494 TSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRGAGPN 558

  Fly   301 KKAARYKLSALVCNKLF 317
            ||.|:...:.....|||
Mouse   559 KKVAKASAALAALEKLF 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
StrbpXP_011237345.1 DZF 81..334 CDD:128842
DSRM_STRBP_rpt1 384..467 CDD:380738 21/89 (24%)
DSRM_STRBP_rpt2 512..575 CDD:380740 19/62 (31%)
SGP <608..664 CDD:375063
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.