DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and adr-2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_498594.1 Gene:adr-2 / 176022 WormBaseID:WBGene00000080 Length:495 Species:Caenorhabditis elegans


Alignment Length:166 Identity:37/166 - (22%)
Similarity:65/166 - (39%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAKQLLAESCA----KVDILEMKKALIP---NPSAEED-AVAVIPLADNLKKTAMG-------- 49
            |..:::...||:    :.::|.::.|::.   :|..... |||.:..||.|:|....        
 Worm   295 MMGERMRTMSCSDKLLRANVLGVQGAILSHFIDPIYYSSIAVAELNNADRLRKAVYSRAATFKPP 359

  Fly    50 ----------GENKSDE---------KGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDA 95
                      ||.:.::         :.|:||....|:|..|..:|.:...:.|   .|:...|.
 Worm   360 APFHVQDVEIGECQVEDTEQSTSAAARSTISSMNWNLADGNTEVVRTSDGMVHD---KDMSGADI 421

  Fly    96 TNGRKKQKKN-KKAKIRPLTMPVTSKDALMVLNELK 130
            |...:..||| .:..|...|:..||.|..:...|||
 Worm   422 TTPSRLCKKNMAELMITICTLTKTSVDYPISYEELK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
adr-2NP_498594.1 dsrm 37..102 CDD:278464
ADEAMc 132..493 CDD:214718 37/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.