DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and D2005.1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001379175.1 Gene:D2005.1 / 172543 WormBaseID:WBGene00008397 Length:323 Species:Caenorhabditis elegans


Alignment Length:240 Identity:46/240 - (19%)
Similarity:74/240 - (30%) Gaps:82/240 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LNELKGVTVDNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLD 190
            ::||..|..:....::..|||...:..:....|        |..:..|..|:.:..|.|:..|..
 Worm    69 IHELSTVDSECSIFEKKEEGKAALKPNLRLVLY--------SNYSPPCIHAVDDAATKKLSYVTP 125

  Fly   191 GPGKSLESDEDDIL-----EKMASYAIHKLGE---EWKTDDIDVATLYNDLKNKQTSVVEPKKPL 247
               .:|....||:|     ::..|..:|...:   :|.|..|..|.|.|.|              
 Worm   126 ---TNLTCVPDDVLTYEQIKETKSLRVHCTADKLFKWNTLGIQGALLSNVL-------------- 173

  Fly   248 PETWKNMHPCMVLNYM--------RPQCTFIVSGGTGTNQNN----TFSMSV------------- 287
                   ||..:.|..        ....::.:.|..|.|:|.    ..||.|             
 Worm   174 -------HPIFIDNIFFGSEAPVSDESLSYALQGRLGPNENEREIIVESMPVQMRMHMGISHLWH 231

  Fly   288 ----CVDNCEFNAEGPSKKAARYKLSALVC--------NKLFGTD 320
                .|:..::|....||.:     .:.||        .||.|.|
 Worm   232 RGVDSVETLDYNTGRTSKGS-----PSRVCKAEIFEAYRKLNGVD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
D2005.1NP_001379175.1 A_deamin 1..317 CDD:413428 46/240 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.