DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and Ilf3

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011240705.1 Gene:Ilf3 / 16201 MGIID:1339973 Length:916 Species:Mus musculus


Alignment Length:294 Identity:72/294 - (24%)
Similarity:108/294 - (36%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLADNLKKTAMGGENKSDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKK- 101
            ||...:.|..   :|::....||...|..     |.::...|..:.:|      .::.:..:|| 
Mouse   356 PLPSKMPKKP---KNENPVDYTVQIPPST-----TYAITPMKRPMEED------GEEKSPSKKKK 406

  Fly   102 --QKKNKKAKIRPLTMPVTSKDALMVLNELKGVTVDNMQIKR-DHEGKIMA-----RVVVNSKKY 158
              |||.:||.      |..:.:|||.||:||    ..:|.|. ...|.:.|     .|.|:...:
Mouse   407 KIQKKEEKAD------PPQAMNALMRLNQLK----PGLQYKLISQTGPVHAPIFTMSVEVDGSNF 461

  Fly   159 EAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDD 223
            ||.|.|..:|:.....|.||:     |.......|:.....||...|.....||           
Mouse   462 EASGPSKKTAKLHVAVKVLQD-----MGLPTGAEGRDSSKGEDSAEESDGKPAI----------- 510

  Fly   224 IDVATLYNDLKNKQTSVVEPKKPLPE-----TWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTF 283
            :....:...:.|  .|.|.|.....|     |....:|.|.||..|....:.:...||.:.:..|
Mouse   511 VAPPPVVEAVSN--PSSVFPSDATTEQGPILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRF 573

  Fly   284 SMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLF 317
            .|.|.||..:|...|.:||.|:...:.....|||
Mouse   574 VMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLF 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Ilf3XP_011240705.1 DZF 106..360 CDD:128842 2/3 (67%)
DSRM_ILF3_rpt1 416..488 CDD:380739 23/86 (27%)
DSRM_ILF3_rpt2 538..609 CDD:380741 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.