DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ADAD2

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_631913.3 Gene:ADAD2 / 161931 HGNCID:30714 Length:665 Species:Homo sapiens


Alignment Length:78 Identity:20/78 - (25%)
Similarity:32/78 - (41%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 ELKGVT----VDNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMK-A 187
            ||.||.    ..|.:.:...:..:.|...:.|:....| |...|:|......:::.|||.:.: |
Human   222 ELDGVVCPAGTANSKTEAKQQAALSALCYIRSQLENPE-SPQTSSRPPLAPLSVENILTHEQRCA 285

  Fly   188 VLDGPGKSLESDE 200
            .|...|..|..||
Human   286 ALVSAGFDLLLDE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ADAD2NP_631913.3 dsrm <217..251 CDD:278464 6/28 (21%)
A_deamin 343..658 CDD:280326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.