DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ADARB1

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_016883731.1 Gene:ADARB1 / 104 HGNCID:226 Length:790 Species:Homo sapiens


Alignment Length:257 Identity:64/257 - (24%)
Similarity:111/257 - (43%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNELK-GVTVDNM-QIKRDHEGKIMARVVVNS 155
            ::.:||..|.:..|:   |....||..|:|||.|||:| |:....: |....|....:..|.||.
Human   105 EEGSNGHSKYRLKKR---RKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNG 166

  Fly   156 KKYEAEGSSVNSARNAACEKALQEIL--TTKMKAVLDGPGKSLE------SDEDDILEKMAS--- 209
            :.:|..|.:...|:..|.||||:..:  ....:|.| ..|::|.      ||:.|..:.:.:   
Human   167 QVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHL-AMGRTLSVNTDFTSDQADFPDTLFNGFE 230

  Fly   210 --------YAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPL-----PETWKNMHPCMVLN 261
                    :.:...|::..:...|::...:.:   ..|:.:|..|:     |.:.||  |.|:||
Human   231 TPDKAEPPFYVGSNGDDSFSSSGDLSLSASPV---PASLAQPPLPVLPPFPPPSGKN--PVMILN 290

  Fly   262 YMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARYKLSALVCNKLFGTDYPQ 323
            .:||...:.....:|.:...:|.|||.||...|...|.:||.|:.:.:......:|.....|
Human   291 ELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQ 352



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.