Sequence 1: | NP_647966.1 | Gene: | blanks / 38620 | FlyBaseID: | FBgn0035608 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001030067.2 | Gene: | Zfr2 / 103406 | MGIID: | 2143792 | Length: | 874 | Species: | Mus musculus |
Alignment Length: | 186 | Identity: | 36/186 - (19%) |
---|---|---|---|
Similarity: | 66/186 - (35%) | Gaps: | 38/186 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 PSAEE-----DAVAVIPLADNLKKTAMGGENKSDEKGTVSSEPKALSDQITSSMRVTKNKIADDK 86
Fly 87 SSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNELKGVTVDNMQIKRDHEGKIMARV 151
Fly 152 VVN-SKKYEAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDEDDILEK 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
blanks | NP_647966.1 | None | |||
Zfr2 | NP_001030067.2 | CytochromB561_N | <72..>169 | CDD:286826 | |
ZnF_U1 | 205..232 | CDD:197732 | |||
C2H2 Zn finger | 207..253 | CDD:275371 | |||
ZnF_U1 | 252..283 | CDD:197732 | |||
C2H2 Zn finger | 254..276 | CDD:275371 | |||
ZnF_U1 | 399..430 | CDD:197732 | |||
C2H2 Zn finger | 402..424 | CDD:275371 | |||
DZF | 586..837 | CDD:295427 | 23/140 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167848521 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |