DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ADAR

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001351974.1 Gene:ADAR / 103 HGNCID:225 Length:1235 Species:Homo sapiens


Alignment Length:324 Identity:70/324 - (21%)
Similarity:113/324 - (34%) Gaps:64/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IPNPSAEEDAVAVIPLADNLKKTAMGGENKSDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSS 88
            ||..:|..:.|.. ...:|.::..:..||:.:.:    .||..|...:..: ..:|....|.::.
Human   403 IPTSNASNNMVTT-EKVENGQEPVIKLENRQEAR----PEPARLKPPVHYN-GPSKAGYVDFENG 461

  Fly    89 DVITDDA------------------------TNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNEL 129
            ...|||.                        ::|..:....||.....|..|::   .|:...:.
Human   462 QWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPIS---GLLEYAQF 523

  Fly   130 KGVTVDNMQIKRD---HEGKIMARVVVNSKKY-EAEGSSVNSARNAACEKALQEILTTKMKAVLD 190
            ...|.:...|::.   ||.:...:||:|.::: .||..|...|:..|..||: .||..:.||  .
Human   524 ASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAM-TILLEEAKA--K 585

  Fly   191 GPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKNMH 255
            ..|||.||         :.|:..|  |..||.:....|      ...||....|.|:....:.||
Human   586 DSGKSEES---------SHYSTEK--ESEKTAESQTPT------PSATSFFSGKSPVTTLLECMH 633

  Fly   256 PCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEF-NAEGPSKKAARYKLSALVCNKLFG 318
            .      :...|.|.:....|......|...|.|....| :...||||.|:...:......|.|
Human   634 K------LGNSCEFRLLSKEGPAHEPKFQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHG 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ADARNP_001351974.1 z-alpha 144..210 CDD:280459
z-alpha 304..368 CDD:280459
DSRM 513..578 CDD:214634 16/68 (24%)
DSRM 624..689 CDD:214634 15/70 (21%)
DSRM 736..801 CDD:214634
ADEAMc 848..1231 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.