DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and CG17147

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:363 Identity:83/363 - (22%)
Similarity:126/363 - (34%) Gaps:103/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 CKDEKDGTIFAYIGNCSEYLICKDNQVQMGHCPPNTLFNPDLLVCDEP---DDVVCLGDRTTTPI 454
            |:..|:||.....|.|.:|:.|.|....:..||.|..|||....|.:.   .:..| |:|     
  Fly    32 CRLFKNGTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKGSCVDTLANSNKYC-GNR----- 90

  Fly   455 PTTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGGGQWTLAP--- 516
                                          |:|.: |...:.|.:|.||:.|:.|     .|   
  Fly    91 ------------------------------CEGLD-GEWVADPTECHKYFYCMNG-----VPLAG 119

  Fly   517 -CIYGSYFDPSTGQC--GPD-VAPDACKPSQVTTTTTTTTT--------ETTTTERNTTPKSTAT 569
             |..|.:||..:..|  |.| :..|.....::....|....        |...|..:.:...|.|
  Fly   120 MCPVGQHFDERSQSCLYGVDSMCVDVNNICELVAENTKFRNEKDCAYYYECDKTGNHASKSCTVT 184

  Fly   570 TTERTTTTVAPKTGICGGRNENENIAY--PNNCTK---------------YIVCVSPIPIAFF-- 615
            :.:|....|  ::|.|...|:.|..|:  .|.||.               |.||.:..|:|..  
  Fly   185 SKKREYFDV--ESGNCVEANKVECTAHSKENVCTSSTTMTFKSDQATCRGYFVCKALYPVADLDP 247

  Fly   616 ----CPDGTFFSSKLEKCIDDWDESDCEGDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQ 676
                ||:|.||....:.|            .:.||:...:.|.....||...||      .:||.
  Fly   248 LWTQCPEGYFFDEDRQLC------------ANPTTVVCTHNRCDGRGTMLVTSS------SNNCH 294

  Fly   677 WFIRCVDDYIYMMDVCNCGEYYDPITEKCGADVPSDAC 714
            .:|||||:.....:.|:...::|...|.|.:.:..|.|
  Fly   295 NYIRCVDNKEVTEETCHWDHFFDETVEACSSKIIYDKC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 16/53 (30%)
CBM_14 485..539 CDD:279884 18/60 (30%)
CBM_14 585..638 CDD:279884 18/75 (24%)
CBM_14 661..714 CDD:279884 14/52 (27%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/32 (34%)
ChtBD2 89..136 CDD:214696 16/87 (18%)
CBM_14 278..332 CDD:279884 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.