DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and CG10725

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:311 Identity:65/311 - (20%)
Similarity:105/311 - (33%) Gaps:101/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 DCSKYYLCLGGGQWTLA---PCIYGSYFDPSTGQCGPDVAPDACKPSQVTTTTTTTTTETTTTER 560
            :||||:||:.    .:|   .|....|||....:|.|.:..:.                      
  Fly    41 NCSKYFLCMN----EIAVPRECPTDYYFDARDQECVPLMEVEC---------------------- 79

  Fly   561 NTTPKSTATTTERTTTTVAPKTGICGGRNENENIAYPNNCTKYIVCVSPIPIAFFCPDGTFFSSK 625
                                 .|.|..|..: :..|...||||::|....|:...|.||..:::.
  Fly    80 ---------------------IGSCKNRGLS-SFCYDRTCTKYVLCFDGTPVIRQCSDGLQYNAL 122

  Fly   626 LEKCIDDWDE-SDCEGDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQWF---IRCVDDYI 686
            .::|  |:.: .||..:                  :|:.::.     ||:..:.   .|| |.|.
  Fly   123 TDRC--DYPQYVDCVDN------------------LCSRNNN-----PDDIVFIPSKARC-DKYY 161

  Fly   687 YMMD----VCNC--GEYYDPITEKCGADVPSDACRWDYTSTTSTTSEPTTTTAV--TRPPPQKGP 743
            ..||    |.||  |..|:|.|:.|           |:.|..:.|.|......:  .|.||:...
  Fly   162 ICMDGLPQVQNCTSGLQYNPSTQSC-----------DFPSKVNCTVESLQRNILPFARAPPRLAD 215

  Fly   744 CDDVEDGA-LVAYPNDCSKYIQCDRPIAVAFECEKGDEFSVELGKCVDASL 793
            .:...:|| .:|:......|..|.....|..:|..|..|..:..:|.:..|
  Fly   216 IECPSEGAHFIAHQKRQDAYYYCLNGRGVTLDCTPGLVFDAKREECREPHL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884
CBM_14 485..539 CDD:279884 13/42 (31%)
CBM_14 585..638 CDD:279884 14/53 (26%)
CBM_14 661..714 CDD:279884 17/61 (28%)
CBM_14 744..796 CDD:279884 11/51 (22%)
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 12/35 (34%)
CBM_14 83..134 CDD:279884 14/53 (26%)
CBM_14 150..192 CDD:279884 16/53 (30%)
ChtBD2 216..264 CDD:214696 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.