DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and CG33986

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:386 Identity:81/386 - (20%)
Similarity:119/386 - (30%) Gaps:150/386 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 TPSITTTPSTPT---TLPSDGSTTEIHSSTTEEIVTTTDGLPSDVDPNDCKDEKDGTIFAYIGNC 408
            |..:|..||.||   |:...||..                         |.:...|....:..:|
  Fly    17 TAQLTWRPSKPTNSVTIRQSGSRI-------------------------CANHLVGEFVEHAEDC 56

  Fly   409 SEYLICKDN-QVQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPIPTTIPTTTTEKTTPTTTT 472
            ..:.:|.:| ...:..|||..|||.:..:||...:|.|..:  |.||.|...........|....
  Fly    57 HMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNE--TDPIETPPFDGGNGDGDPNNMV 119

  Fly   473 TTVAT---TLGPDQLCDGQ--ELGASFSYPDDCSKYYLCLGGGQWTLAPCIYGSYFDPSTGQCGP 532
            |..||   ||...|....:  .:|:|.|    |.|||:|. .||..|..|....:::..||:|  
  Fly   120 TDAATYCSTLVEQQQSSDRIVYVGSSSS----CRKYYICY-YGQAILQECSSQLHWNAMTGKC-- 177

  Fly   533 DVAPDACKPSQVTTTTTTTTTETTTTERNTTPKSTATTTERTTTTVAPKTGICGGRNE---NENI 594
            |:                                    .||...||       ||:.:   |.|.
  Fly   178 DI------------------------------------PERAQCTV-------GGQEDMPTNGNS 199

  Fly   595 AYPNNCTKYIVCVSPIPIAFFCPDGTFFSSKLEKCIDDWDESDCEGDQSTTTLEPGYTRPPPEPT 659
            .:|:.                   ||..||.|..|                   |.|        
  Fly   200 GFPSG-------------------GTAISSDLIHC-------------------PAY-------- 218

  Fly   660 MCTNSSRDTFPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPITEKCGADVPSDACRWDYTS 720
                 .:..:|:...|::||.||..:..:.   .|..||       ..|:.:.:|:|..|:
  Fly   219 -----GQHLYPHMQRCEFFIYCVKGHASLQ---QCPFYY-------FFDIATKSCQWSRTA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 13/51 (25%)
CBM_14 485..539 CDD:279884 16/55 (29%)
CBM_14 585..638 CDD:279884 11/55 (20%)
CBM_14 661..714 CDD:279884 10/52 (19%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 13/50 (26%)
CBM_14 141..185 CDD:279884 18/86 (21%)
ChtBD2 213..261 CDD:214696 14/89 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.