DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and CG32302

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:313 Identity:64/313 - (20%)
Similarity:98/313 - (31%) Gaps:102/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 QELGASFSYPDDCSKYYLCLGGGQWTLAPCIYGSYFDPSTGQCGPDVAPDACKPSQVTTTTTTTT 552
            |:.|. |..|.||.:|:.|......|...|..|:.:...||.|......:.|...|.|.:     
  Fly    94 QQAGL-FPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCS----- 152

  Fly   553 TETTTTERNTTPKSTATTTERTTTTVAPKTGICGGRNENENIAYPNNCTKYIVCV-----SPIPI 612
                                        ::|..||...:....|        |||     |..|:
  Fly   153 ----------------------------RSGQVGGWAPDNRYFY--------VCVNDTANSLYPL 181

  Fly   613 AFFCPDGTFFSSKLEKCIDDWDESDCEGDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQW 677
            ...|.:|..|:|  ..|:.|        .:|..:::      ..|...|.|:.|...|:..:...
  Fly   182 MMKCHEGFVFNS--YSCVPD--------TRSMRSIQ------AMESHTCMNNDRYQCPFRTSEIE 230

  Fly   678 FIRCVDDYIYMMDVCNCGEYYDPITEKCGADVPSDACRWDYTSTTSTTSEPTTTTAVTRPPPQKG 742
            :.:|||..:.:| .|..|...||....|..|                               :..
  Fly   231 YCKCVDGELEVM-TCPAGFQIDPKILTCVTD-------------------------------RIY 263

  Fly   743 PCDDVEDGALVAYPNDCSK--YIQC-DRPIAVAFECEKGDEFSVELGKCVDAS 792
            .|.|.|   :::.||..:|  |..| |..:.: :.|..|..|:.|..||...|
  Fly   264 QCSDFE---ILSCPNVSTKDEYCICIDHQLQI-YSCPMGQYFNAETRKCQSES 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884
CBM_14 485..539 CDD:279884 14/50 (28%)
CBM_14 585..638 CDD:279884 14/57 (25%)
CBM_14 661..714 CDD:279884 14/52 (27%)
CBM_14 744..796 CDD:279884 16/52 (31%)
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.